Search
Menu
Bristol Instruments, Inc. - 872 Series High-Res 4/24 LB
Photonics Marketplace

Show Filters
Hide Filters
Suppliers by Category

Regions

US States

Countries

Optimax Systems, Inc. - Optical Components & Systems 2024 MR
HIWIN Corp. - Linear Motor Stages HP 6/24
0 suppliers

Aerial Cameras

An aerial camera is designed for the imaging of the earth's surface in order to obtain high quality aerial images.

Clear All Filters xmonocrystalline substrate xCameras & Imaging xCameras xAerial Cameras x

Sorry... your search has produced no results.
Please refine your selections or clear all filters to try again.

Clear All Filters

Glossary
  • aerial camera Camera designed for the imaging of the earth's surface in order to obtain high quality aerial images
  • photogrammetry Photogrammetry is a technique used to obtain accurate three-dimensional measurements of objects and environments through the analysis of photographs or imagery. It involves extracting information about the shape, size, and spatial properties of...
  • camera A light-tight box that receives light from an object or scene and focuses it to form an image on a light-sensitive material or a detector. The camera generally contains a lens of variable aperture and a shutter of variable speed to precisely control...
  • aerial photogrammetry The application of aerial photographs as a means of measurement in map making and surveying.
Aerial Cameras Suppliersoverheadphotogrammetryphotographyaircraftspaceimagingimagevisionpicturemilitaryreconnaissancephotogrammetric equipment

We use cookies to improve user experience and analyze our website traffic as stated in our Privacy Policy. By using this website, you agree to the use of cookies unless you have disabled them.